PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0500s0002.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family GATA
Protein Properties Length: 148aa    MW: 16042.6 Da    PI: 10.6982
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0500s0002.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.76.9e-181952134
                 GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34
                         C+ Cgt  TplWR+gp g+k+LCnaCG+++rk++
  Kaladp0500s0002.2.p 19 CAMCGTARTPLWRSGPAGPKSLCNACGIKQRKRK 52
                         9*******************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577161.28E-121159No hitNo description
SMARTSM004012.4E-121367IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.8731349IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.0E-141752IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.03E-111852No hitNo description
PfamPF003201.4E-151952IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MDLSQKETAM LSDETKKRCA MCGTARTPLW RSGPAGPKSL CNACGIKQRK RKALMCKNPD  60
KKKQRQPTTT NPAASPPSTS TEPPSKSKPG LEKSCATNSR QSVKVGLAAF GKDLALLQRQ  120
RSLRRQRSEE EEAAMLLMSL SCSYVLG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A103XGE32e-24A0A103XGE3_CYNCS; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06740.11e-18GATA transcription factor 15